DPCstruct | MC484
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 134 ± 11 aa |
| Standard deviation of domain lengths | 11.00 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A2R387 | 5-125 | SDYLLLAKSYVDGKVYVSTIKASDLKESPKWEGTENPPLSAKKAESLAREKAMQLAKKKFADYVLESISINYLRTQNVWCYEVSYRN… |
| A0A5C6FN10 | 38-161 | DLAHIWSQSHVADATYLTVLSEEALANAPRWHPADPNPPVSARAALAIADRHRSKILDDDSIYDWRLDSVSLLPLDAKNDKWCWSIY… |
| A0A7Y3ZER5 | 13-152 | None |
| A0A849MJX1 | 17-168 | None |
| A0A4Q2XR84 | 14-148 | None |
| A0A7Y4UBL3 | 15-147 | None |
| A0A7W4FLE3 | 9-128 | None |
| A0A286RJG6 | 153-289 | None |
| A0A2V5X1X0 | 7-141 | None |
| A0A5B9PBV9 | 14-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.