DPCstruct | MC48396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 141 ± 24 aa |
| Standard deviation of domain lengths | 24.45 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 71.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A178AHA9 | 46-192 | GDELGLEISVDLLAALTGAQHVVDYRDSAMMKGYSHLFVPVKKRPESVQWHMIVSPDAGRWVKYEDSATLIASGGSIAKVSIAEATS… |
| A0A2J6R1I4 | 87-202 | GSCWRPLFRNPVIVEGYPILARAHGEKGLEIPLDMMAGLSQASRVTNFGGGLVIKGFSTMFCPTKRIKNSVLWHYLFSHDGKRMSYL… |
| A0A0L1JIZ9 | 278-417 | None |
| R1EC65 | 158-312 | None |
| A0A6A5SCG2 | 53-218 | None |
| A0A2P4ZP35 | 176-312 | None |
| A0A5N6WBV5 | 9-148 | None |
| G3JD53 | 543-649 | None |
| A0A146FNX1 | 388-506 | None |
| A0A5N6ED00 | 230-374 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.