DPCstruct | MC48393
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 221 ± 28 aa |
| Standard deviation of domain lengths | 27.99 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 46.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05559 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5WDJ6 | 2-186 | SLLGGAIVEAVVMEYGRGELLRRLSDPFWFQSLGCVLGMDWHSSGITTSVMNALKKSVNLRSSELGVYICGGRGRSSRQTPAELLDV… |
| A0A832DEN2 | 3-253 | TGITTMTLDWGQCPPWLFERMKRLARVIVLAIVSEYGSYEFIRRLADPVWFQSLGTLMAFDWNASGLTVTTMAAVKEALRGLEKDAD… |
| A0A832K964 | 31-252 | None |
| A0A256YCY8 | 5-247 | None |
| A0A2M7R479 | 1-246 | None |
| A0A5E4KI76 | 8-224 | None |
| A0A2V2UGB1 | 5-211 | None |
| A0A7J4F6T4 | 1-165 | None |
| A0A7C4MG83 | 1-217 | None |
| X1R9N2 | 2-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.