DPCstruct | MC48390
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 269 ± 18 aa |
| Standard deviation of domain lengths | 18.09 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13265 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K7S7R7 | 29-302 | ASEENGIIYSRRGGFIDMAHLRDQSDWTAYLYTQILEHKKKGSLSIILGREGGEKTLNVSIPTNLNNQDLINLAGKIAYDLSVWHEI… |
| A0A826Y8W6 | 3-235 | LWPRLGQAFVLSPGRDELAQRRLVFRAFTPPSSVRDRYVLAAEISARLAYQLAVWHEIAQWYGFESVPGYPETVSAFSPEDLWSNLL… |
| A0A1V8M8P8 | 145-428 | None |
| A0A1Y5FGD0 | 61-325 | None |
| A0A2S3QU77 | 103-393 | None |
| A0A838F574 | 1-259 | None |
| A0A3N5UVQ6 | 191-482 | None |
| A0A534QZG7 | 11-297 | None |
| A0A0Q7MDQ2 | 385-623 | None |
| D2TWI3 | 2-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.