DPCstruct | MC4839
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 159 ± 18 aa |
| Standard deviation of domain lengths | 18.10 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C5V7T1 | 184-339 | DIDWDDYHPSAREILDDPFYWSCTDDTAPHGNDTGADLLHSFLKWNKRNRTTDPLRFLDRLLDEWGFQPIDWTVTDPAMVNAMGSSD… |
| A0A6M8HFY3 | 1-188 | MHRGRMLAALAAVLVLGGCGSGNTTEPVGPQSSSTTGSTNETSADGADLPDADPAFAEHFTDPVYDDPAGEFAPFGTDEGFDLVWEW… |
| A0A4P8ZMQ6 | 4-170 | None |
| A0A1H2N557 | 1-150 | None |
| A0A518DC82 | 105-285 | None |
| A0A2P2CBD8 | 8-148 | None |
| A0A5R8QHW2 | 12-168 | None |
| A0A151BVF1 | 312-460 | None |
| A0A1M5RBS5 | 112-255 | None |
| A0A2P8HKF6 | 166-339 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.