DPCstruct | MC48386
Metacluster Properties and Pfam Annotations
| Number of structural domains | 160 |
|---|---|
| Mean domain length (aa) | 139 ± 34 aa |
| Standard deviation of domain lengths | 34.02 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 78.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 29.82 |
| Pfam Score | 63.05 |
| Assigned Pfam label(s) | PF07534- CL0033 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6RXG9 | 1-111 | MKEIEVWEHVLKWGLAQNPTLIPDPKSWSVEDFKIMRNTLQHCLPLVRFFCLSSKEFSQKVRPYQKLLNQQLYEDLLKFFLESDNVS… |
| A0A2H5RWH4 | 1-81 | MSEIQVWEHVLKWGLAQNPELPSDITNYSKDDFNALKSTLQQFIPFIKFYNLTSKEFLDEVFPYREILPEELFINLLKDIS |
| A0A397SLB0 | 47-166 | None |
| A0A397SUX5 | 60-168 | None |
| A0A2Z6RB85 | 462-618 | None |
| A0A397SWT5 | 186-302 | None |
| A0A397SXF0 | 42-123 | None |
| A0A6S7I243 | 324-463 | None |
| A0A372Q148 | 38-160 | None |
| A0A372Q304 | 46-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.