DPCstruct | MC48384
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 105 ± 11 aa |
| Standard deviation of domain lengths | 10.85 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N1M0W5 | 57-182 | LPVLTMIAPVLAKTKPYIGQEPPDDYLDRLIQSISFAQGHMTVLENANAGDFDDVVKCDIFKAQMGGKYLPVPAQDPYNGNANINSP… |
| A0A2Z6RUT2 | 4-103 | IQDVMHTLAPLLAQLPNYDGQEPPDVYYQKLRNINEMARPLAVAAFNATARCQVMINKMIGRFAPVPANDPYAAGNPAINTKPLFLN… |
| A0A397SBN6 | 7-111 | None |
| U9T2I5 | 92-211 | None |
| A0A397J584 | 9-122 | None |
| A0A397IBP0 | 1-86 | None |
| A0A2Z6RJT7 | 1-94 | None |
| A0A397U5G5 | 200-293 | None |
| A0A397VCF4 | 1-99 | None |
| A0A2Z6QVW0 | 7-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.