DPCstruct | MC48376
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 77 ± 4 aa |
| Standard deviation of domain lengths | 4.31 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 45.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0012 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6RH93 | 1-75 | MPSLYPRATLKRIIKSHQSKALSKNVDVLIYLHCVLFLQKLAQEANSEAGTDKAKVVERKHVKAALERVLQEFQG |
| A0A5F4WA14 | 14-83 | YKTLKQVFKQQKPQLRLEKSGDLLVHLSCLLFVHLLAEESRTNTCENKCRVINKEHVLAAAKVILKKSQG |
| A0A423X4P6 | 1-75 | None |
| A0A261Y665 | 1-76 | None |
| A0A5N3W5I5 | 3-87 | None |
| A0A7N9IB11 | 3-81 | None |
| A0A5F4WI78 | 3-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.