DPCstruct | MC48373
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 281 ± 38 aa |
| Standard deviation of domain lengths | 38.10 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 41.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6RDG7 | 1-331 | MELAKINDENTFDPTPKLKSSPIPIKFISFNMNDSKCIFCGEVYSEVLFNNWQKYCEKCLSCYLTNITHINMYFDVYYTTNLECNYG… |
| A0A2I1HLQ2 | 12-264 | FEPTSKLKSSPIQISFVPFNINKSVCDCGNVYSETILLQKFCKNCLFVYIKNIKNFDAYLDIHYKKHLGIEEQFEILSEGLYFKQII… |
| A0A2I1EIV5 | 1-276 | None |
| A0A372Q153 | 78-344 | None |
| A0A372QK40 | 160-421 | None |
| A0A372QLW1 | 12-268 | None |
| A0A2Z6RKI7 | 1-318 | None |
| U9UYU3 | 2-270 | None |
| A0A015L8S0 | 3-328 | None |
| U9UES2 | 1-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.