DPCstruct | MC48372
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 92 ± 8 aa |
| Standard deviation of domain lengths | 7.82 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 43.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6RDF5 | 1-89 | MSNLLRLAIIMPFLLNQFLKESSLKRNEAVTIQQRINASRISLVPKNIIACWVHVAKTMKTVFNRKFTSDSYEELQQYLEEEFSILP… |
| A0A2H5SNF7 | 328-410 | LRLGMVMPFILNRFLVSNCLKPQEMEKLQVRTNLNRNQVINAIVKCWAIVAKCSRLAFKNSLTNNDYIVLEKYLKMEQKALIE |
| A0A015LJ97 | 1-88 | None |
| A0A015LIG2 | 107-198 | None |
| A0A015LFB9 | 1-96 | None |
| U9UAS7 | 212-298 | None |
| A0A2H5SSD5 | 16-110 | None |
| A0A2H5SGJ9 | 699-786 | None |
| A0A2H5R182 | 26-125 | None |
| A0A2N0NHM7 | 91-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.