DPCstruct | MC48371
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 90 ± 9 aa |
| Standard deviation of domain lengths | 8.65 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 36.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6RBB6 | 23-123 | VRTLPGHSWKNLVKRIISILNLGLQCIGFMRQEMDKELEEIMSKCNNMNDIRKAAEKASKLKNELKESLNPTITLLNDLFKRLQLKD… |
| A0A015JHF4 | 20-101 | LNLDLQGVALLRDQMSSEIEDLFSRKNTLEEIRLVAKNNSQLESELRNSIKSIQQFLNRQTERLVLDNKNFICKSPADDEEI |
| A0A015ND24 | 81-168 | None |
| A0A2B4RNR3 | 1-90 | None |
| A0A2N1KVY1 | 1-92 | None |
| A0A7M5XPM3 | 1-87 | None |
| A0A2Z6RZH8 | 3-87 | None |
| A0A2Z6REK7 | 500-600 | None |
| A0A2Z6R8E6 | 1-88 | None |
| A0A2I1EML2 | 48-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.