DPCstruct | MC4837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 84 ± 10 aa |
| Standard deviation of domain lengths | 9.65 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A074LK75 | 11-96 | EQENKEIELSRECNKAFIPHKLENGDTEKQLLARSRYLLFKGEDKWTVSQVHCAEILFQRYPDLEKAYKLSRSLARIYQTSKIKGI |
| A0A1T5EQH7 | 57-132 | KEAKEKGIEYQSEVLENGDTRKQLLARSRYLLFKPEEKWTLSQWHRAHILFELYPDIKIAYELSYGLCKIYNRQIS |
| A0A1N6QGH7 | 19-108 | None |
| A0A1I2MYF4 | 46-138 | None |
| A0A2H1YBX9 | 13-114 | None |
| A0A3L7ZV68 | 9-114 | None |
| A0A1I1ZNJ0 | 20-107 | None |
| A0A2G2K4I6 | 26-103 | None |
| A0A7U8L5L3 | 8-90 | None |
| A0A521EN96 | 2-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.