DPCstruct | MC48363
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 182 ± 10 aa |
| Standard deviation of domain lengths | 10.24 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z9U6S9 | 1-167 | MSCRFFELGFDKYRYDFPLELWRFPIEVRKSIAEGYDAAELQQASRKRPTIYEKKLMTIKGRAYAKGLTVSISAQDLENELLKTHYC… |
| A0A2N2TGV4 | 160-339 | LSTEMQARIRSTGFELGWDMARHGMPMPDDLGRMVPEFAEGWGAAHEHFGARTVKPDTYTRKWLTVRGSALRRNRIFDSEVTPAFLR… |
| A0A5C7PAL0 | 78-265 | None |
| A0A1E4NW85 | 4-185 | None |
| A0A0K8NXN1 | 30-213 | None |
| A0A4P1JT51 | 7-173 | None |
| A0A661E1Q5 | 1-194 | None |
| A0A126ZBE0 | 1-178 | None |
| A0A2E8JS56 | 34-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.