DPCstruct | MC48360
Metacluster Properties and Pfam Annotations
| Number of structural domains | 493 |
|---|---|
| Mean domain length (aa) | 198 ± 42 aa |
| Standard deviation of domain lengths | 42.45 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 75.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 20.44 |
| Pfam Score | 97.91 |
| Assigned Pfam label(s) | CL0114- CL0123- CL0012- CL0003- PF12554 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1GX55 | 47-258 | GRAPLSSFKVGVPPAMHLRGGKGSKVKPDEYSEFKAPKKALSAYMLFANDIRNKVAEENPELKMTQLSSVIGQKWKDISAEDKAKYD… |
| A0A2T9YKY9 | 104-308 | EKAKKLKLKAELHKKLTSTRKIVNPPSLSSRPMTLFLKDSYEKIKNSQQTIDDKSCRKIFIGLALEWKQLPEVEKLEYKKRTDILKE… |
| A0A0H2S2C8 | 22-243 | None |
| A0A5N5TIV4 | 71-326 | None |
| A0A6S7GQS1 | 151-371 | None |
| A0A388LG84 | 583-823 | None |
| H0EZM6 | 4-249 | None |
| A0A7S4PAG4 | 540-743 | None |
| A0A061QRQ4 | 542-733 | None |
| A0A1D2N538 | 34-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.