DPCstruct | MC48359
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 140 ± 16 aa |
| Standard deviation of domain lengths | 15.61 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 93.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1EL26 | 1-129 | ETIADKAYVNTGVDAINQRILGRYQNGLGKTWDDPRHMKFFDDGAVNFPYLSDGMWFLTQHKRWGLIKDHPDYLGTAKAINQTALYS… |
| A0A1H8VCC5 | 58-211 | AVMEAQQWCESMDNKAEMADILGKRQWFNVPTKDVLGRLKGDINYGNGREVKATDLYMKFWKDGASYPFKSHDTWFMAENIRWGNLP… |
| A0A831XUM1 | 90-231 | None |
| A0A7C5BEL0 | 70-225 | None |
| A0A7R9P249 | 729-859 | None |
| A0A831XU83 | 1-172 | None |
| A0A328V7X1 | 25-151 | None |
| A0A090VS09 | 3-122 | None |
| A0A7W1WEW4 | 42-168 | None |
| A0A7Y4UEN3 | 171-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.