DPCstruct | MC48347
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 171 ± 15 aa |
| Standard deviation of domain lengths | 15.34 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 19.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E6GV42 | 1-160 | MNCPSCSKKINPKAIRCPYCKTVLVSKEKFSETVKKRKEKSLETEKKDFIKSGRNTLLIVGGLNIIPLFIYLSQGDDLSAIIQGIIA… |
| A0A537A4K1 | 83-266 | KPIKCAACDTLAKPYDRFCGKCGKPMPTAEDYENRKNVKAATGAIKVLAVVFVIAGIAFFFITKGAADTALVKLEGADPATTYPTPI… |
| A0A2G2F6W8 | 19-180 | None |
| A0A3E1NR66 | 31-218 | None |
| A0A1I5SBR6 | 27-193 | None |
| A0A0F9W847 | 2-178 | None |
| A0A2A4GEE6 | 1-164 | None |
| A0A523U4L1 | 3-185 | None |
| A0A7T9D7K9 | 14-165 | None |
| A0A1S1YXM1 | 6-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.