DPCstruct | MC48342
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 96 ± 15 aa |
| Standard deviation of domain lengths | 14.98 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.49 |
| Pfam Score | 47.83 |
| Assigned Pfam label(s) | PF20339- PF09133 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K8K6J6 | 61-158 | DSFRGYIRGLDATLPTMDDLETAPELCRWSLVRRPASAYCQLTGYVTGHPQLDWGSPVVTSTVFRIGPGLQWARTWSRFYRLTEYDP… |
| A0A3S4GEV7 | 8-95 | TLKRALKDWEKLSNGHSPSADDLSNAPLLTDWEPRWTATGVMFLVGQVRGHPKLADGPCSTSVVLAADVREGWARTISRYYRLGPQRG |
| A0A1N6EBY1 | 5-90 | None |
| A0A1E7FWT8 | 34-115 | None |
| A0A4W4DN08 | 366-482 | None |
| A0A0S9SFU4 | 17-119 | None |
| A0A7G5LHD2 | 74-158 | None |
| A0A2W5K593 | 4-71 | None |
| A0A850Q8D1 | 1-117 | None |
| A0A349Y117 | 94-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.