DPCstruct | MC4834
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 111 ± 9 aa |
| Standard deviation of domain lengths | 8.69 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17217 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060Z528 | 1-104 | MEKQMGGKLLDEPKTLNFKDSTHNLRLSIHDVPHTLWKSKLLAKYQELSFQQVWSGSQRNLHCTFTLERFCPSTVNLACKLCVRQVE… |
| A0A2H1CDV4 | 235-343 | ESRLDGRLLDSTKPFPFRDNGIGLSFRIEDVSQGWRSRLQTRIQEIPFRHIWSGTQISMLHCAFSLEHVDPTYSNVSCHIVVYQEKN… |
| A0A4S2LR32 | 1003-1103 | None |
| A0A6I9YZ37 | 444-543 | None |
| A0A2G8LI16 | 646-764 | None |
| A0A5C6MZY7 | 53-175 | None |
| A0A444U3I3 | 580-689 | None |
| A0A430QJN4 | 1039-1160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.