DPCstruct | MC48325
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 149 ± 25 aa |
| Standard deviation of domain lengths | 24.72 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 68.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03909 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7N0UWD5 | 1-130 | MISDQRQCGTATEDELLGVTRELIDFIKTFTVDTFKDFQFRGDDDHDDGNATSPPGHVRTDLSHWQARHAKLVLSKVKEMSNLRYTL… |
| C6TED3 | 13-162 | RLDDDDDGVLGVTEDVVAFARSVALHPETWLDFPLPDDEDSDDFDLSDAQQEHALAVEHLAPSLAALRMELCPGYMSDGNFWKIYFV… |
| F0ZEE0 | 19-158 | None |
| A0A7J8LH98 | 3-203 | None |
| A0A5P1FED8 | 8-203 | None |
| A0A1R3HP20 | 87-247 | None |
| A0A5B8MGZ0 | 107-223 | None |
| A0A6P6G771 | 1-90 | None |
| A8J2J0 | 75-238 | None |
| A0A7N0VAN5 | 112-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.