DPCstruct | MC48324
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 134 ± 26 aa |
| Standard deviation of domain lengths | 25.80 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 75.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 36.02 |
| Pfam Score | 98.57 |
| Assigned Pfam label(s) | PF15024- PF10218 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K8EVZ3 | 6-137 | RQCVNTKQGLHHITDDNGYTCDWFDVFPPTGCCPPEKAIEKRYGCSACDLAKGGETEKCCGTYESCVSCCQNAKVSTAETDRTREPI… |
| A0A7N0UQD8 | 22-154 | TAIRKDVGFPEPRFCRTSVQGRYLLADDNGHVCDALALDPETRCCPSTGGQYSCQGCNTISQCCDSYEFCVSCCLDPARTRKEEVLK… |
| F4Q0L3 | 914-1046 | None |
| A0A6I8NZQ6 | 224-360 | None |
| G5A2K8 | 155-322 | None |
| A0A1X7TNY7 | 2-97 | None |
| A0A482X286 | 33-128 | None |
| A0A158RAY2 | 28-152 | None |
| A0A7S0D987 | 75-201 | None |
| A0A4Z2CTA9 | 31-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.