DPCstruct | MC48321
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 105 ± 21 aa |
| Standard deviation of domain lengths | 20.88 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 71.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F8NVP4 | 1-111 | MTTFEELKRRYQQLLTQYQSGKFTSAQFLAEVQQLRTQDSTGTWWAINAQDGSFLRYDGSQWVPARPPTPAPKTPKGKSTFKLPELP… |
| A0A0Q1BQ12 | 5-92 | DFDEAQQRFARLTTQRSQGQIPEDRYRTQVNELRVQDPSGTWWQPDPDSGGWIFWDGSAWVPGTPPKRAAPAQKPRPEAPRSQPVPEG |
| A0A3A0AZR0 | 2-142 | None |
| A0A4V1QQT7 | 15-110 | None |
| A0A1V5WFE3 | 3-144 | None |
| A0A524AS73 | 2-76 | None |
| A0A399ZPP5 | 2-106 | None |
| A0A367ZQ18 | 3-115 | None |
| A0A367ZKQ9 | 1-90 | None |
| A0A532U7Y3 | 2-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.