DPCstruct | MC4832
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 74 ± 5 aa |
| Standard deviation of domain lengths | 4.73 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 62.23 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | CL0110- CL0318 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2W547 | 1-73 | MLFSLIPALEILNLLLNPGKTQSHEFVMEVTDKTKGDVKGGTLIQYENKIRLLEIPQVPKERVDEFKSVNKFK |
| A0A0D2SG19 | 17-91 | VFVANSDNLGAIVDLKILNHLVQNKNEYCMEVTPKTLADVKGGTLISYEGKVQLLEIAQVPDEHVNEFKSIEKFK |
| A0A819E7F4 | 907-980 | None |
| A0A078I219 | 466-540 | None |
| A0A3Q2CEA4 | 86-164 | None |
| J9F5Z2 | 20-92 | None |
| A0A812B0C3 | 252-326 | None |
| A0A498NFB1 | 575-652 | None |
| A0A0C2GPX7 | 1-75 | None |
| A0A811RKA6 | 29-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.