DPCstruct | MC48312
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 302 ± 26 aa |
| Standard deviation of domain lengths | 25.61 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E7N708 | 77-376 | LPHRLESGERSFAFYRGPLTATPAQALPAPADPRLESAGEALVYLRAHGVFDTGYASAFSLGRTLALADAPFRGKLLEFRKAARRAV… |
| A0A6M5FZF2 | 2-305 | IYDAQSAVFDLSLACAWEAGRLSAVSDQVYVRQILALRKKAQQIADVLFSRMLSRAAESGKKDTLDRPEEFAQSARKELEQLGKEEW… |
| A0A0B4GV34 | 319-657 | None |
| A0A2T5LKV6 | 370-657 | None |
| A0A2L2TUM2 | 90-353 | None |
| A0A5B2VM80 | 356-647 | None |
| A0A0F4GR08 | 482-788 | None |
| W9NNH6 | 418-715 | None |
| A0A4Q2VGX5 | 212-509 | None |
| A0A1V5F5H8 | 167-514 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.