DPCstruct | MC48303
Metacluster Properties and Pfam Annotations
| Number of structural domains | 274 |
|---|---|
| Mean domain length (aa) | 115 ± 28 aa |
| Standard deviation of domain lengths | 28.06 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 82.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.23 |
| Pfam Score | 98.76 |
| Assigned Pfam label(s) | CL0441- CL0020- PF07426 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813NA27 | 20-141 | VSLSLPYALHASCLHMQVRSGSKTKNLVQFAMRKLFPTDQNAINVEQITWNAFGDGISKAIACAELTKRRSQLNFYEYVQIGYKRIE… |
| A0A3S0ICJ1 | 1-83 | MMQLKVASNSAPKALAGAVSGLLRAEPQVELLAVGPHAVNQAVKALAIARGYLEADGIDVIVQPAFAPAAQGGVQLVLLATAI |
| A0A835J2W4 | 120-197 | None |
| S7RN20 | 3-185 | None |
| A0A843X233 | 1-122 | None |
| A0A447G300 | 170-270 | None |
| A0A1X2IMC1 | 151-298 | None |
| A0A7S0A4M2 | 84-193 | None |
| A0A7C9DIL5 | 2-69 | None |
| U2Z819 | 375-468 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.