DPCstruct | MC48302
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 242 ± 44 aa |
| Standard deviation of domain lengths | 44.39 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 69.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 29.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0760 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813MFS3 | 2-254 | LQEHNLTLVVFHGSNLKARQWTLFSLQDPQINFVTDRGENDDINQKLFFYLGHQGQTISATPKSRINMASTSKVIRNSNEAPPSHLT… |
| A0A0N4T691 | 19-258 | CGQFISIGQQASLVLMEGEITANRWALFYLNQPTLIFSSAAQYTFLDEKQTIGIDLSEKLLLKLNGATKENKISDNNWTSVICKVER… |
| A0A7R9CJA6 | 313-514 | None |
| A0A194QNK2 | 904-1224 | None |
| A0A5S6PBY6 | 1970-2238 | None |
| A0A1L8HUN8 | 1-249 | None |
| A0A7R9IZD0 | 255-436 | None |
| A0A0R3RW34 | 771-1026 | None |
| A0A815NEQ5 | 8-295 | None |
| A0A0N4XPP9 | 7-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.