DPCstruct | MC48301
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 127 ± 26 aa |
| Standard deviation of domain lengths | 25.71 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 52.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822HYA3 | 1-124 | KNSGEWILEKIADGEQGEKQQINYYGSGGADIGKVGSDTFAYIAAIEPFHGNVVSVYTKVTNNSLSQIQWQRHILDVYGHPNQNGEG… |
| A0A815ABS5 | 95-234 | NWLYFNQNLTKWMIENIGDGEQKQQQIPFYGSGGIDLGRVGNDSFAYMPAIEPFHGNVISVYIKTMKNSLKQNQWKRYVLDVFGYPN… |
| A0A167A070 | 8-164 | None |
| A0A0M8N8K8 | 186-329 | None |
| A0A820NF51 | 121-216 | None |
| A0A817ULI1 | 43-147 | None |
| A0A0U1M3N0 | 266-435 | None |
| A0A821HIC4 | 741-881 | None |
| A0A814WWD2 | 1-92 | None |
| A0A820HZU9 | 85-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.