DPCstruct | MC4830
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 107 ± 17 aa |
| Standard deviation of domain lengths | 17.27 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K4B2V4 | 115-231 | RGNRANGLITPHRPMSMEATSGKNPINHIGKIYNLLSNELAHTCVEKVDGIAEIQIRLLSQIGDPIDQPLVASAQIIPKPSFTVKDI… |
| A0A151EW00 | 1-101 | MSMEAAAGKNPVSHVGKLYNVLARKMAHEIAAIDGIEEVQIYLLSQIGHPINDPAEACAKIITNNATVSELESEIEETIIRNIEDVK… |
| A0A7C0Y622 | 15-116 | None |
| A0A7C0XQW7 | 31-147 | None |
| A0A7V3HCF1 | 57-167 | None |
| A0A2D0JJH1 | 18-127 | None |
| L9W556 | 26-99 | None |
| A0A4C2EVF8 | 534-663 | None |
| G2MMB1 | 152-260 | None |
| A0A838U9S3 | 282-380 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.