DPCstruct | MC483
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 75 ± 9 aa |
| Standard deviation of domain lengths | 9.35 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R0F6W1 | 4-66 | ESDLIAGDTVVFIDESKPCGLMTVHKVQGNGVLLDGNRSFALIHLIRHANVQELNAGKRLGGW |
| A0A1B2LZ39 | 2-68 | TKTDFKVGDLVVAINGDDRVFTFSSYMTDGRVLLKCKHGRSYCYSKHWFRPATAEEVAANRRLGVTN |
| A0A6G0V6Z5 | 49-122 | None |
| A0A241ZI61 | 123-190 | None |
| A0A857IT77 | 25-110 | None |
| A0A1I6WDC9 | 4-74 | None |
| A0A2T1J1I5 | 8-84 | None |
| A0A7Y8TX64 | 26-106 | None |
| A0A0Q7ERK6 | 65-128 | None |
| A0A3A8ESL9 | 5-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.