DPCstruct | MC48298
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 63 ± 4 aa |
| Standard deviation of domain lengths | 3.73 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 80.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 70.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05700 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822HMY7 | 17-78 | AHGHQPAPDVIVDALPYYDSGYDEPGAREAALSLVEDETRRYKPTKNYLEQLGQPLYHAFET |
| A0A182VCL5 | 2-64 | AGEVLVDALPYIDLGYDDPGVREAAIAMVEEECRRYRPTKNYLEHLPALNTTAFETELMAAEF |
| G3NMR1 | 1-63 | None |
| A0A7R8WU70 | 2-64 | None |
| A0A452EKL9 | 1-69 | None |
| A0A336MKL7 | 2-65 | None |
| A0A2K5PXH5 | 1-66 | None |
| A0A2A4JPW5 | 1-57 | None |
| A0A6P7VTL0 | 2-64 | None |
| A0A7R8ZM17 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.