DPCstruct | MC48297
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 82 ± 14 aa |
| Standard deviation of domain lengths | 13.60 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 51.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822HLI6 | 2-100 | LVVGYSNHSKAFIVRKSWGEYWGDDGYCYIPYDYMANPDLSFQVYAVRQAETDDIGHEYWIKDDSINYHPDIIDEDDDDDCDIIEEE… |
| S9P844 | 6-70 | ETGPANHAVAIVGWDDEKGAWLVRNSWGVKWGLNGYMWIKYQVNSIGTDASWIRAAYSPGEMYAR |
| A0A817C5H2 | 2-77 | None |
| A0A819S292 | 45-131 | None |
| A0A818N2G7 | 1-118 | None |
| A0A812QPV4 | 16-93 | None |
| A0A819QTF3 | 1-61 | None |
| A0A815S5E6 | 8-98 | None |
| A0A815YAP7 | 1-69 | None |
| A0A820PSV2 | 217-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.