DPCstruct | MC48282
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 211 ± 35 aa |
| Standard deviation of domain lengths | 34.96 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.73 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06102 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L8D3V5 | 25-224 | MSFENLQKLKDRLGTKVYNETMFGKKGKRKVEFKRENRNRPREMSAKRPVRVLKEVVSVKKVVSRDPRFDSLCGTFDSKAFKRSYAF… |
| H0VX02 | 13-217 | AEMSFEELLKLQNQVGTNTHKELVAKNKKPASRASARNACVADKHRPLEMSAKVRVPFLRQVVPISKKVARDPRFDDLSGEYNPEVF… |
| A0A146H7Y7 | 59-309 | None |
| Q4U8J3 | 4-246 | None |
| A0A813W4Q0 | 4-208 | None |
| A0A0C9UBM8 | 16-282 | None |
| A0A482VAN4 | 28-241 | None |
| A0A177WC34 | 51-274 | None |
| A0A4W6DX39 | 131-274 | None |
| A0A066WGN5 | 57-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.