DPCstruct | MC48280
Metacluster Properties and Pfam Annotations
| Number of structural domains | 123 |
|---|---|
| Mean domain length (aa) | 260 ± 55 aa |
| Standard deviation of domain lengths | 54.98 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 71.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 15.11 |
| Pfam Score | 41.95 |
| Assigned Pfam label(s) | PF08577- CL0271- PF11566 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A194RGH2 | 11-253 | ENISSLLDTLSREVLSQNKGTEPVQNDLFYVLIIVLMLENGFLPVINDSEVMENINSYDVQHLIPKKLETGLYEAKFVMFGCPDFPL… |
| A0A1Y1KBW4 | 20-220 | NVFTYCIKSGICVDKNDTMAIFIYIMMLEAGFVTPDYSNPQEESTCNVHSSFHYQRFLHLTRALPKNWKQNNVYNFTFILAPFTQHQ… |
| A0A817Q7N0 | 141-422 | None |
| A0A835XW56 | 282-568 | None |
| A0A097H178 | 7-182 | None |
| A0A819PDE0 | 96-341 | None |
| A0A061R0Z6 | 8-198 | None |
| A0A653C2A6 | 14-260 | None |
| A0A0G4HG89 | 2-299 | None |
| J6F3K8 | 88-482 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.