DPCstruct | MC4828
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 273 ± 51 aa |
| Standard deviation of domain lengths | 51.47 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 24.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01312 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6ZGV8 | 62-371 | EKTEPATPRKREEARRRGHVLRSREVTQAASLVAGLLVLGLVAGDIKAKVQGFAVRTWGSLDAFDLSFATVLWLTRELGYAVLVTVL… |
| W8RRK0 | 4-318 | AEKPADKPHEPTPRKLEDARKKGEIPRSADLNTAVTYGGFLLAGAMLAPWLVQTLGDLMRASLGQADRMAAVILAPGGTTTAAAVIG… |
| A0A2E8KK48 | 8-238 | None |
| A0A3T0K6G2 | 162-473 | None |
| A0A3G2G0G4 | 188-520 | None |
| Y0KH22 | 1-315 | None |
| A0A2H2JKS7 | 129-349 | None |
| A0A7C6PMK4 | 294-610 | None |
| M6UEL1 | 398-711 | None |
| A0A6S4QT06 | 112-424 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.