DPCstruct | MC48276
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 78 ± 8 aa |
| Standard deviation of domain lengths | 7.55 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 46.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I1FB56 | 1-78 | MASQPHFNDHYKDLLNQLPPSIKKEVWLRLTTRKYNPLTEEQAGRIHPDIDSLLTKEVNRYYKKKDRQRLKVDANTTP |
| A0A015JSI8 | 3-78 | FNQAYTELLVMLPASVIHKVWIRLTTRKCSPLSVSDASEVNSMVKLFLKHEVERYQKKLAHQRITVKQTYMPRNRM |
| A0A2N0PYW3 | 1-69 | None |
| A0A2N1NJH1 | 1-81 | None |
| A0A397J6P5 | 1-90 | None |
| A0A397IUP4 | 152-229 | None |
| A0A397IUM0 | 221-294 | None |
| A0A397I7U2 | 12-75 | None |
| A0A2H5T0B8 | 828-918 | None |
| A0A2Z6RPT3 | 154-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.