DPCstruct | MC48273
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 76 ± 13 aa |
| Standard deviation of domain lengths | 13.08 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 44.50 |
| Pfam Score | 98.44 |
| Assigned Pfam label(s) | PF07061- PF05254 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I1EYK6 | 1-72 | MSQSIGSQCNELKKEYDACFNKWYSEKFLKGDIRPECEELFKKYKDCVMVAVKQKQIDKLLVEARKDDPFTS |
| A0A4Q0A2T1 | 1-66 | MESVGKECTQLKHQYEECFNKWYTEKFLKGDHSPDCQDLFNKYRSCVFKTLKERNMLDTIDGARKE |
| F2SE26 | 1-56 | None |
| A0A135SVN4 | 1-93 | None |
| A0A507FPZ6 | 1-78 | None |
| A0A6P5VP48 | 1-51 | None |
| A0A1D2N4N0 | 69-156 | None |
| A0A0C2J580 | 29-85 | None |
| A0A670JRN2 | 98-159 | None |
| A0A421JPS8 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.