DPCstruct | MC4827
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 170 ± 19 aa |
| Standard deviation of domain lengths | 18.61 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V2YNK2 | 24-202 | GNRGTLHGPDLALGTTRWRSKAWICCVLDWKGVQRDPMPTGRWTALFFFDEAVALAAGHRPCAYCRRRDFLRYAGAWAQGNALDERP… |
| W8RNN6 | 2-183 | MGNRGILHDAQRRLGTARWRHKAWVCCALSFKGRQRKVMTPGTYTELFFLDEAVAMAAGHRPCAECRRADYTRFARAWATAAGQPAR… |
| A0A7S3AFI3 | 79-282 | None |
| A0A7I7UFR5 | 178-340 | None |
| A0A2R8B552 | 23-206 | None |
| A0A1F4ADS1 | 6-159 | None |
| A0A1Q8Y1M5 | 23-199 | None |
| A0A2E5C609 | 2-184 | None |
| C8XFZ0 | 36-210 | None |
| A0A7Y5W2G8 | 1-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.