DPCstruct | MC48269
Metacluster Properties and Pfam Annotations
| Number of structural domains | 93 |
|---|---|
| Mean domain length (aa) | 115 ± 11 aa |
| Standard deviation of domain lengths | 11.12 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A386ZKD8 | 220-334 | PPRMARVYDGKDADGKPVVNRPELDGNSRTAVLAYLESAPIVLAARSFDQDEFVPGDRDVPLTFRTDGVWVWAGAVSHYLHKHGLAP… |
| H6RBV8 | 4-122 | LRPVGIFREMYSGGHDDLPSLFGSFTQRPIEDRARVIDYLRAAPPVLDVLDVERDLIDNTQQITSAATLHSDGTWIWRVDSIHYLGR… |
| A0A222F8B7 | 5-85 | None |
| A0A7W5FF87 | 100-217 | None |
| A0A173MFE5 | 119-229 | None |
| A0A1V9YWU9 | 1-129 | None |
| A0A810LE52 | 5-117 | None |
| A0A1I5K3G5 | 200-308 | None |
| A0A7W7CKF9 | 3-97 | None |
| A0A7S2NSU1 | 4-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.