DPCstruct | MC48268
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 347 ± 48 aa |
| Standard deviation of domain lengths | 48.15 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 16.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14362 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A386ZCI2 | 43-426 | VVGVRSKDLMGADGEPLTFDRTRYFVVGLSVVITALFAFAAMTTAAALMVGHLSWGFVGLGALWSAFIFNIDRWVVSSFDYDFDGKP… |
| A0A1T4M7A3 | 5-283 | ITKRFMVGMIGIDYDELRRSADKNLDRFHWAAIFVAVILMLSLFSVYYAFELMFHKWYVQFLLSLFFSLMFGIIYVLLLQTISKKPL… |
| A0A7Y2A780 | 2-260 | None |
| A0A450TP96 | 8-354 | None |
| A0A3M1Z250 | 3-292 | None |
| D0TU42 | 11-318 | None |
| A0A401XLX6 | 20-278 | None |
| B5IJ68 | 7-429 | None |
| A0A1Q7CWN7 | 10-369 | None |
| A0A4Q1D581 | 1-407 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.