DPCstruct | MC48265
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 70 ± 13 aa |
| Standard deviation of domain lengths | 12.98 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H5XRV6 | 20-92 | LIMRPRLLKFLSCPKCKSVFQLYSKKRDKEKIIEGSLVCENCQAVYPIYRGIPRILDRENLSNEKRKIAMRFG |
| A0A161QB82 | 1-68 | MRLKTIEKLCCPFDKQELELTIVKQETEESVEEGYLLCNNCRRVYPIVSGIPIMSPDEYREFELERPL |
| A0A353H683 | 1-66 | None |
| A0A534WH80 | 1-74 | None |
| A0A135VXT2 | 1-86 | None |
| A0A535KUM4 | 37-130 | None |
| A0A2E5NY88 | 1-55 | None |
| A0A1I4EXI7 | 1-58 | None |
| A0A497MWW7 | 1-76 | None |
| A0A2P6VY24 | 1-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.