DPCstruct | MC4826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 152 ± 19 aa |
| Standard deviation of domain lengths | 18.83 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 40.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E4FYD3 | 1-118 | MDFGDDSSRWANDEQCDDPRFSGEGMAPVLERADLWSDASDCQAAFAAGTITYIGEEPELPPVEFDYGDDWSEWANDGECDDPRFTG… |
| A0A1J0VAI6 | 29-178 | AILPLALLFLILVPRDGPEGGIVFGDDSSSRAFNDTCDDPRFTGPAAGRMLSASDMGRDASDCQRLYRVAEGLRGRFRGPSVRYNAL… |
| A0A7C5C9L2 | 70-225 | None |
| A0A3B0ULP0 | 445-599 | None |
| A0A2R8AD74 | 1-177 | None |
| A0A7G5LIH2 | 2-132 | None |
| A0A844Z1D5 | 14-174 | None |
| A0A0N4Z8Y6 | 743-905 | None |
| A0A6M1SJ80 | 2-166 | None |
| A0A349E9M9 | 7-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.