DPCstruct | MC48254
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 290 ± 24 aa |
| Standard deviation of domain lengths | 24.02 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12934- CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8CGB2 | 1-299 | MDPQKMPYLKEEPYFGMGKMAVSWHHDENLVERSAVAVYSHSFADPEEESEDDPQLEGRDPDIWHVGFKISWDIETPGLAIPLHQGD… |
| A0A7R9Y7A4 | 156-444 | MEPASRCAEVPLKDEALFGMGKTSVSWHSDSSLQDVSTVAVYHQTDDDDDDSWAVALKTLDGVTPAMRTPLRSREMYYMLRDFNAHH… |
| A0A6J2EZZ8 | 237-491 | None |
| A0A813I311 | 554-888 | None |
| A0A6G0WHV1 | 213-495 | None |
| A0A6I9Z1Z2 | 1-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.