DPCstruct | MC4825
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 103 ± 12 aa |
| Standard deviation of domain lengths | 11.91 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 17.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G6DAD1 | 111-210 | GDEAATVAGVYTYGHEVESFTLCDTKAGYWVTGQKVLLDTLRNASLDKSKQLKKPYQGVYAELRLAMLPKAEDGFAADYDHVVKVLE… |
| A0A1J0V8Z9 | 1-120 | MRIAPADEPRVLDGEVYAGFERFAFNICRTDEESGDDCPLQRGKGGDRGECWLQLDETARDDLIALTGSDYVEDGSYRLQGTGTVRT… |
| G5SUX4 | 206-291 | None |
| A0A523LPY1 | 13-111 | None |
| A0A7W3QR07 | 13-111 | None |
| A0A1H7Y6Y3 | 14-106 | None |
| A0A6G6Y163 | 84-179 | None |
| A0A0B1YLJ2 | 104-203 | None |
| A0A521VUP6 | 117-205 | None |
| A0A1E4B5Y9 | 69-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.