DPCstruct | MC48248
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 85 ± 7 aa |
| Standard deviation of domain lengths | 6.84 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0052 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A653C879 | 1-84 | MKSEHLGNVKQRMGGALVLHANHKMEVPLLWAHSTETMVLGFMKTTSDKPKCIISELPKDVPAGHTVTVSGRCFYLQKNNKQEI |
| A0A6A4JXI5 | 2-67 | GSSKLCGVLAVKKDPEGGGELAWAHTTQSMAVGFISSNFSSPKFQISRLPKSVAPGSSVNVQGVSW |
| A0A7J7W1M9 | 9-95 | None |
| A0A2K6GGY0 | 261-348 | None |
| A0A7J7KPK4 | 40-125 | None |
| A0A7J7YBD1 | 145-229 | None |
| A0A315VR65 | 318-410 | None |
| F4Q6J9 | 69-155 | None |
| A0A2T7NYL2 | 359-447 | None |
| A0A7J8HLY2 | 220-307 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.