DPCstruct | MC48247
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 286 ± 40 aa |
| Standard deviation of domain lengths | 39.73 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.70 |
| Pfam Score | 93.81 |
| Assigned Pfam label(s) | PF17103- PF17102 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A653C7T1 | 24-337 | SNVHWHFQSNSHVDAYSASLQHTNRMLNNRYGFRTRKVPSHAPILIDKEIVTRLQETFLKEFEVTERNRVRRYDDIQFSFAYYYYLM… |
| A0A834KEI7 | 281-543 | QLDTYAESLLYVNKIYNIIYGFDRRKVPAHMPHLIDKWIVNSMQRKFESDFIKTSSHKIRNAEDMQFAFSYFYFLMSENLYIPVGDI… |
| A0A6L5CD92 | 169-461 | None |
| A0A553MXE1 | 1-243 | None |
| A0A2B4SPZ5 | 889-1207 | None |
| A0A7R9UDI4 | 528-861 | None |
| C1MR99 | 2-249 | None |
| A0A6J0WK18 | 664-1000 | None |
| A0A1I8MLT6 | 36-294 | None |
| A0A811VI77 | 128-468 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.