DPCstruct | MC48241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 79 ± 11 aa |
| Standard deviation of domain lengths | 10.79 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A653BUB2 | 53-128 | EYTFRYADLTTKLCDPSQLRAKPDVSELKFGQIFTDHMLKVFYHKQLRGWQKPSIIPFENISLHPAAKVLHYSIEE |
| L5LGE1 | 3-70 | TLKAKDLIITPATILKEKPDPNSVGFGTVFTDHMLTIEWSSEFGWEKPHIKPFQNLSLHPASSALHYA |
| A0A815GLY3 | 11-83 | None |
| A0A0D8XM21 | 6-87 | None |
| A0A5N4DT94 | 80-167 | None |
| A0A183HI12 | 40-123 | None |
| A0A0B1S6L6 | 7-112 | None |
| S7NFC8 | 133-214 | None |
| A0A7J8CE01 | 24-103 | None |
| K2ST37 | 23-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.