DPCstruct | MC4824
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 104 ± 13 aa |
| Standard deviation of domain lengths | 12.72 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J0V5S3 | 13-106 | AAVEEAEAHPLGSAENPVRTAQPSGQRAYLSRLRCADGSTPAYQRIGSFGFGPYGNIVDGYEVRCPDADPKTVVMDMYHPGHVEERA… |
| A0A4Q3CNK5 | 24-125 | GGLKGKKLEAAIQKAEVEPLGSEKNPVRVNMPGGERNYLARLRCADGSRPSFERAGSMGIGPFGNILDLYPVACTGKDAVDVYMDMY… |
| A0A0R0D8S4 | 6-136 | None |
| A0A1Z9Y332 | 148-269 | None |
| A0A3M1EPJ8 | 25-123 | None |
| F4AWG9 | 2-85 | None |
| A0A1F3KEM2 | 3-113 | None |
| A0A1G9YML6 | 9-93 | None |
| A0A255TUH8 | 117-229 | None |
| A0A7Y4N9L0 | 2-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.