DPCstruct | MC48239
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 422 ± 50 aa |
| Standard deviation of domain lengths | 49.53 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10493 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A653BP64 | 38-450 | LLYPKFKDLLANVDECVQHIVNLERATSLVYHLMYHIPNGADKVDAARMSYEYARKYRQANPDVAEVENSYVKVKSKYFQYSAMHIL… |
| A0A3L6VHD1 | 16-310 | SPKKLIELVYFKYGQQAWTTQTSVVHDTALKIATLNDADLATIQHEIRWKWLSARHTKPPTKQTVWNYLTDDDEDARLGRLLYISWT… |
| S4R4E1 | 490-935 | None |
| A0A6G0XV54 | 659-1102 | None |
| A0A194RL02 | 340-749 | None |
| F1NPK2 | 28-396 | None |
| A0A0B1SZ76 | 468-909 | None |
| A0A146LH57 | 1-359 | None |
| A0A1A8M8V5 | 373-806 | None |
| A0A4U5NEU8 | 165-624 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.