DPCstruct | MC48237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 65 ± 6 aa |
| Standard deviation of domain lengths | 5.92 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 38.78 |
| Pfam Score | 71.43 |
| Assigned Pfam label(s) | CL0001- PF21164 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482VTY0 | 127-187 | ECTINPECPSNLACIREKCRDPCPGSCGSGAQCTVINHTPICTCPEGFTGDPFNYCQPKPP |
| A0A1B0CXB8 | 4-73 | CQADSECPDHRACIALQCVDPCVNQCGVGADCHAKRHVAVCTCPAGTSGDALVSCRQSRSYPVARYYKKK |
| E9IKA4 | 115-184 | None |
| A0A3Q0IMX2 | 197-260 | None |
| A0A3Q0ISQ0 | 63-113 | None |
| A0A1A9XJQ5 | 50-117 | None |
| A0A7R8WYA5 | 502-569 | None |
| A0A0L7K2U7 | 104-164 | None |
| B4IS52 | 79-141 | None |
| A0A498MIT5 | 699-760 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.