DPCstruct | MC48234
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 104 ± 11 aa |
| Standard deviation of domain lengths | 11.39 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10120 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2A0Z6 | 1-104 | MKRSNEKDLVLGNIVRAIRMLEKSHSFAYLIPEVRTNLVYALLNAKSKEDVAGIDGRITVVNGFPKASGFLKFGTSSHMARFIIEIM… |
| A0A7J2N050 | 58-158 | AAEKWRVYEELKDAVDLLINMDIVDFIPEVGMNFAYALPYPYARSTEDVAAIEGRIVKAGKKARAGEITFGASRHLAKAVLKAMEYD… |
| A0A832LT16 | 1-85 | None |
| A0A2R6CZN1 | 270-374 | None |
| A0A7V4K374 | 24-150 | None |
| A0A497N733 | 129-227 | None |
| A0A849Q545 | 387-490 | None |
| A0A7J2LAT0 | 1-87 | None |
| A0A2H6JTR0 | 287-389 | None |
| U1NB64 | 130-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.