DPCstruct | MC48229
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 121 ± 19 aa |
| Standard deviation of domain lengths | 18.73 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2TBG7 | 1-117 | MQKPFLRSNLYPFDFEKRCLYCGETVNKEAYNKHLHRYLKICQVETVPKISSILSMCTKRCDKWGKIVLNRIGRECDLIPVDEQYHK… |
| A0A8B6F9F2 | 8-99 | ITEPTRDLRSSTPDFEFQKNCLFCGYFAKFSESKRGIDVFPVRTTDFSNTLRNICKERNDEWSEIVLRRLNIAPSDLHAADAIYHQT… |
| A0A7M5WWH2 | 7-124 | None |
| A0A7M5XAR3 | 78-182 | None |
| A0A5B7JBW6 | 9-137 | None |
| A0A4Y2J4I5 | 67-207 | None |
| A0A8B6BVZ1 | 95-240 | None |
| A0A8B6BMV5 | 80-206 | None |
| R7TYP4 | 79-171 | None |
| A0A6J8EIT6 | 84-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.